KCNIP4 Rabbit Polyclonal Antibody
Other products for "KCNIP4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | potassium voltage-gated channel interacting protein 4 |
Database Link | |
Background | KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. |
Synonyms | CALP; KCHIP4 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.