Rabbit Polyclonal Anti-RSPO3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | RSPO3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human RSPO3. |
Rabbit Polyclonal Anti-RSPO3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | RSPO3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human RSPO3. |
Mouse Monoclonal STEP Antibody (23E5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PTPN5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PTPN5 Antibody: synthetic peptide directed towards the middle region of human PTPN5. Synthetic peptide located within the following region: VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE |
Rabbit Polyclonal Anti-PTPN5 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTPN5 |