Products

View as table Download

Rabbit Polyclonal Anti-STK16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL

STK16 mouse monoclonal antibody, clone M2, Purified

Applications ELISA, IHC, RNAi, WB
Reactivities Human

Rabbit Polyclonal Anti-STK16 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STK16