Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 Antibody: A synthesized peptide derived from human EPN1 |
Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 Antibody: A synthesized peptide derived from human EPN1 |
Rabbit polyclonal anti-EPN1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPN1. |
Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 antibody: synthetic peptide directed towards the C terminal of human EPN1. Synthetic peptide located within the following region: AATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPG |
Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 antibody is: synthetic peptide directed towards the C-terminal region of Human EPN1. Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP |
EPN1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-180 of human EPN1 (NP_037465.2). |
Modifications | Unmodified |