Products

View as table Download

Rabbit anti-NCF2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NCF2

Rabbit Polyclonal Anti-NCF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF2 antibody is: synthetic peptide directed towards the C-terminal region of Human NCF2. Synthetic peptide located within the following region: TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF

Rabbit Polyclonal Anti-NCF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NCF2

NCF2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NCF2