Rabbit anti-NCF2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NCF2 |
Rabbit anti-NCF2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NCF2 |
Rabbit Polyclonal Anti-NCF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCF2 antibody is: synthetic peptide directed towards the C-terminal region of Human NCF2. Synthetic peptide located within the following region: TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF |
Rabbit Polyclonal Anti-NCF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NCF2 |