Products

View as table Download

MAT2A mouse monoclonal antibody, clone AT3A2, Purified

Applications ELISA, IHC, WB
Reactivities Human

MAT2A mouse monoclonal antibody, clone AT3A2, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit Polyclonal Antibody against MAT2 alpha

Applications WB
Reactivities Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153]

Rabbit Polyclonal Antibody against MAT1/2 alpha

Applications WB
Reactivities Human, Rat, Bovine, Zebrafish, Orang-Utan, Monkey (Does not react with: Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human MAT2A protein (within residues 100-200). [Swiss-Prot# P31153]

Rabbit Polyclonal Anti-MAT2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2A antibody: synthetic peptide directed towards the middle region of human MAT2A. Synthetic peptide located within the following region: LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK