Products

Antibodies (6)
cDNA Clones (4)
Proteins (3)
Jump to Filters
View as table Download
myosin heavy chain 9 (MYH9) Rabbit Polyclonal Antibody
TA346515

USD 475.00

5 Days

Rabbit Polyclonal Anti-MYH9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYH9 antibody: synthetic peptide directed towards the middle region of human MYH9. Synthetic peptide located within the following region: DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK
Lymphotactin (XCL1) (22-114) Mouse Monoclonal Antibody [Clone ID: 1E1]
AM31697PU-N

USD 480.00

2 Weeks

Lymphotactin (XCL1) (22-114) mouse monoclonal antibody, clone 1E1, Purified

Applications ELISA, IHC, WB
Reactivities Human