Products

View as table Download

Goat Anti-Delta-Sarcoglycan (aa245-257) Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLPHGSYTPTGTR, from the internal region of the protein sequence according to NP_000328.2; NP_758447.1; NP_001121681.1.

Rabbit Polyclonal Anti-Sgcd Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sgcd antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ