Products

View as table Download

Rabbit Polyclonal Anti-ABCB9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW

Goat Anti-ABCB9 / TAPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1.

Rabbit anti-ABCB9 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCB9.

Anti-ABCB9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9

Anti-ABCB9 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ABCB9, swissprot No.:Q9NP78-2.