Products

cDNA Clones (45)
Proteins (12)
RNAi (12)
Gene Expression (8)
Antibodies (5)
Jump to Filters
View as table Download
ABCB9 (NM_019625) Human Tagged ORF Clone
RC213150

USD 610.00

In Stock

ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Abcb9 (NM_019875) Mouse Tagged ORF Clone
MR210524

USD 700.00

In Stock

Abcb9 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RC221068

USD 610.00

In Stock

ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 Human Gene Knockout Kit (CRISPR)
KN413150

USD 1,290.00

2 Weeks

ABCB9 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN413150 is the updated version of KN213150.
Abcb9 Mouse Gene Knockout Kit (CRISPR)
KN500620

USD 1,290.00

2 Weeks

Abcb9 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN500620 is the updated version of KN300620.
Abcb9 (NM_019875) Mouse Tagged ORF Clone
MG210524

USD 770.00

3 Weeks

Abcb9 (GFP-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Abcb9 (NM_019875) Mouse Tagged ORF Clone
MR210524L3

USD 900.00

3 Weeks

Lenti ORF clone of Abcb9 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_019875) Mouse Tagged ORF Clone Lentiviral Particle
MR210524L3V

USD 1,100.00

6 Weeks

Lenti ORF particles, Abcb9 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_019875) Mouse Tagged ORF Clone
MR210524L4

USD 900.00

3 Weeks

Lenti ORF clone of Abcb9 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_019875) Mouse Tagged ORF Clone Lentiviral Particle
MR210524L4V

USD 1,100.00

6 Weeks

Lenti ORF particles, Abcb9 (GFP-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone
RC213150L3

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone Lentiviral Particle
RC213150L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone
RC213150L4

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019625) Human Tagged ORF Clone Lentiviral Particle
RC213150L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (mGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RC221068L3

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone Lentiviral Particle
RC221068L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RC221068L4

USD 810.00

3 Weeks

Lenti ORF clone of Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_203444) Human Tagged ORF Clone Lentiviral Particle
RC221068L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, ABCB9 (mGFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RC221127

USD 610.00

4 Weeks

ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RC221127L3

USD 810.00

4 Weeks

Lenti-ORF clone of ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone Lentiviral Particle
RC221127L3V

USD 1,010.00

7 Weeks

Lenti ORF particles, ABCB9 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RC221127L4

USD 810.00

4 Weeks

Lenti-ORF clone of ABCB9 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_019624) Human Tagged ORF Clone Lentiviral Particle
RC221127L4V

USD 1,010.00

7 Weeks

Lenti ORF particles, ABCB9 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ABCB9 (NM_001243014) Human Tagged ORF Clone
RC234709

USD 720.00

5 Weeks

ABCB9 (Myc-DDK tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_001243013) Human Tagged ORF Clone
RC234747

USD 610.00

5 Weeks

ABCB9 (Myc-DDK tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019625) Human Tagged ORF Clone
RG213150

USD 670.00

3 Weeks

ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_203444) Human Tagged ORF Clone
RG221068

USD 670.00

3 Weeks

ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_019624) Human Tagged ORF Clone
RG221127

USD 670.00

5 Weeks

ABCB9 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_001243014) Human Tagged ORF Clone
RG234709

USD 790.00

5 Weeks

ABCB9 (GFP-tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCB9 (NM_001243013) Human Tagged ORF Clone
RG234747

USD 670.00

5 Weeks

ABCB9 (GFP-tagged) - Homo sapiens ATP-binding cassette, sub-family B (MDR/TAP), member 9 (ABCB9), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Abcb9 (NM_022238) Rat Tagged ORF Clone
RR201836

USD 1,030.00

5 Weeks

Abcb9 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Abcb9 (NM_022238) Rat Tagged ORF Clone
RR201836L3

USD 1,220.00

12 Weeks

Lenti ORF clone of Abcb9 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_022238) Rat Tagged ORF Clone Lentiviral Particle
RR201836L3V

USD 1,440.00

16 Weeks

Lenti ORF particles, Abcb9 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_022238) Rat Tagged ORF Clone
RR201836L4

USD 1,330.00

12 Weeks

Lenti ORF clone of Abcb9 (mGFP-tagged ORF) - Rat ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_022238) Rat Tagged ORF Clone Lentiviral Particle
RR201836L4V

USD 1,600.00

16 Weeks

Lenti ORF particles, Abcb9 (GFP-tagged ORF) - Rat ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Abcb9 (NM_019875) Mouse Untagged Clone
MC203590

USD 210.00

In Stock

Abcb9 (untagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
ABCB9 (BC017348) Human Untagged Clone
SC123606

USD 310.00

In Stock

ABCB9 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 9 (cDNA clone MGC:29663 IMAGE:5014247), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ABCB9 Rabbit Polyclonal Antibody
TA331839

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABCB9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCB9 Antibody: synthetic peptide directed towards the N terminal of human ABCB9. Synthetic peptide located within the following region: RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW
ABCB9 Goat Polyclonal Antibody
TA305813

USD 375.00

5 Days

Goat Anti-ABCB9 / TAPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1.
ABCB9 Rabbit Polyclonal Antibody
TA310140

USD 205.00

3 Weeks

Rabbit anti-ABCB9 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCB9.
Abcb9 Mouse shRNA Plasmid (Locus ID 56325)
TL503148

USD 815.00

2 Weeks

Abcb9 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Human ABCB9 activation kit by CRISPRa
GA108319

USD 1,290.00

2 Weeks

ABCB9 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily B member 9

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Abcb9 activation kit by CRISPRa
GA205911

USD 1,290.00

2 Weeks

Abcb9 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family B (MDR/TAP), member 9

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ABCB9 Human qPCR Template Standard (BC017348)
HK200014

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene ABCB9

Application Plasmid of exact quantity for transcript copy number calculation
ABCB9 Human qPCR Primer Pair (NM_019625)
HP229089

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ABCB9

Abcb9 Mouse qPCR Template Standard (NM_019875)
MK202986

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Abcb9

Application Plasmid of exact quantity for transcript copy number calculation
Abcb9 Mouse qPCR Primer Pair (NM_019875)
MP201137

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Abcb9

Abcb9 (NM_022238) Rat Untagged Clone
RN201836

USD 1,030.00

6 Weeks

Abcb9 (untagged ORF) - Rat ATP-binding cassette, sub-family B (MDR/TAP), member 9 (Abcb9), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ABCB9 (NM_019624) Human 3' UTR Clone
SC211227

USD 560.00

4 Weeks

3`UTR clone of ATP-binding cassette sub-family B (MDR/TAP) member 9 (ABCB9) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
ABCB9 (NM_203444) Human 3' UTR Clone
SC211228

USD 560.00

4 Weeks

3`UTR clone of ATP-binding cassette sub-family B (MDR/TAP) member 9 (ABCB9) transcript variant 4 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase