Products

View as table Download

Rabbit Polyclonal antibody to ACOX3 (acyl-Coenzyme A oxidase 3, pristanoyl)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 408 and 603 of ACOX3

Rabbit Polyclonal Anti-ACOX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT

Anti-ACOX3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl

Anti-ACOX3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl

ACOX3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human ACOX3 (NP_001095137).