Germany
Japan
United Kingdom
China
ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Acox3 (Myc-DDK-tagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACOX3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN422515 is the updated version of KN222515.
Acox3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500742 is the updated version of KN300742.
Acox3 (GFP-tagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acox3 (Myc-DDK-tagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acox3 (Myc-DDK-tagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acox3 (mGFP-tagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acox3 (GFP-tagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acox3 (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acox3 (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acox3 (Myc-DDK-tagged ORF) - Rat acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acox3 (mGFP-tagged ORF) - Rat acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acox3 (GFP-tagged ORF) - Rat acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of acyl-Coenzyme A oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ACOX3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ACOX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
ACOX3 CRISPRa kit - CRISPR gene activation of human acyl-CoA oxidase 3, pristanoyl
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Acox3 CRISPRa kit - CRISPR gene activation of mouse acyl-Coenzyme A oxidase 3, pristanoyl
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ACOX3
ACOX3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Acox3 (untagged) - Mouse acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Acox3
ACOX3 MS Standard C13 and N15-labeled recombinant protein (NP_003492)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Acox3 (untagged ORF) - Rat acyl-Coenzyme A oxidase 3, pristanoyl (Acox3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of acyl-Coenzyme A oxidase 3 pristanoyl (ACOX3) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of acyl-Coenzyme A oxidase 3 pristanoyl (ACOX3) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Acox3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Acox3 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ACOX3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl |
Active filters
Target Symbol
- ACOX3