ADAM12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADAM12 |
ADAM12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADAM12 |
Rabbit Polyclonal Anti-ADAM12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE |
Goat Polyclonal Antibody against ADAM12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673. |
Goat Anti-ADAM12 (aa225-239) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2. |
Rabbit polyclonal anti-ADAM12 antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ADAM12 |
Anti-ADAM12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12 |
ADAM12 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 589-738 of human ADAM12 (NP_067673.2). |
Modifications | Unmodified |