ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM12 (GFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ADAM12 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, Adam12 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, ADAM12 (mGFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ADAM12 (GFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Adam12 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADAM12 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ADAM12 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
ADAM12 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Adam12 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Adam12 (mGFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Adam12 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM12 (mGFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ADAM12 (mGFP-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADAM12 (mGFP-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADAM12 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM12 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADAM12 (untagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
3`UTR clone of ADAM metallopeptidase domain 12 (ADAM12) transcript variant 1 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
Lenti ORF clone of Adam12 (mGFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
ADAM12 (untagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADAM12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ADAM12 |
Adam12 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
Format | Retroviral plasmids |
Vector | pRS |
Rabbit Polyclonal Anti-ADAM12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE |
Lenti ORF clone of Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ADAM12 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against ADAM12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673. |
Goat Anti-ADAM12 (aa225-239) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2. |
Rabbit polyclonal anti-ADAM12 antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ADAM12 |
ADAM12 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Adam12 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
Human ADAM12 ELISA Kit
Assay Type | Sandwich ELISA kit of Quantitative Detection for Human ADAM12 |
Reactivities | Human |
Rat ADAM12 ELISA Kit
Assay Type | Sandwich ELISA kit of Quantitative Detection for Rat ADAM12 |
Reactivities | Rat |
Mouse ADAM12 ELISA Kit
Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse ADAM12 |
Reactivities | Mouse |
ADAM12 CRISPRa kit - CRISPR gene activation of human ADAM metallopeptidase domain 12
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Adam12 CRISPRa kit - CRISPR gene activation of mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha)
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ADAM12
Application | Plasmid of exact quantity for transcript copy number calculation |