Germany
Japan
United Kingdom
China
ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadADAM12 (GFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ADAM12 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Adam12 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, ADAM12 (mGFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ADAM12 (GFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Adam12 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM12 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ADAM12 (Myc-DDK tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADAM12 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412501 is the updated version of KN212501.
Adam12 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500816 is the updated version of KN300816.
Lenti ORF clone of Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adam12 (mGFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adam12 (GFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM12 (mGFP-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM12 (Myc-DDK-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ADAM12 (mGFP-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADAM12 (mGFP-tagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADAM12 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM12 (myc-DDK-tagged) - Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADAM12 (untagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
3`UTR clone of ADAM metallopeptidase domain 12 (ADAM12) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Lenti ORF clone of Adam12 (mGFP-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
ADAM12 (untagged)-Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Adam12 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Rabbit Polyclonal Anti-ADAM12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE |
Lenti ORF clone of Adam12 (Myc-DDK-tagged) - Mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha) (Adam12)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ADAM metallopeptidase domain 12 (ADAM12), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ADAM12 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of ADAM metallopeptidase domain 12 (ADAM12), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Polyclonal Antibody against ADAM12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673. |
Goat Anti-ADAM12 (aa225-239) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2. |
Rabbit polyclonal anti-ADAM12 antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ADAM12 |
ADAM12 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Adam12 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Human ADAM12 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human ADAM12 |
| Reactivities | Human |
Rat ADAM12 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rat ADAM12 |
| Reactivities | Rat |
Mouse ADAM12 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse ADAM12 |
| Reactivities | Mouse |
ADAM12 CRISPRa kit - CRISPR gene activation of human ADAM metallopeptidase domain 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Adam12 CRISPRa kit - CRISPR gene activation of mouse a disintegrin and metallopeptidase domain 12 (meltrin alpha)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ADAM12
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- ADAM12