Products

View as table Download

ADGRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADGRG1

Rabbit Polyclonal Anti-GPR56 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN

Rabbit Polyclonal Anti-GPR56 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GPR56 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human GPR56. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Chimpanzee, Elephant, Panda, Bovine, Pig (94%); Mouse, Rat, Hamster, Dog, Bat, Horse, Rabbit, Opossum (88%).

Rabbit Polyclonal Anti-GPR56 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen GPR56 antibody was raised against synthetic 19 amino acid peptide from 1st cytoplasmic domain of human GPR56. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Pig (95%); Bovine, Rabbit (89%).

ADGRG1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADGRG1

ADGRG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ADGRG1.