Products

View as table Download

AGFG2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-AGFG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AGFG2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AGFG2. Synthetic peptide located within the following region: NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKG