USD 484.00
In Stock
Rabbit monoclonal antibody against Apolipoprotein H(clone EPR2898(2))
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
USD 484.00
In Stock
Rabbit monoclonal antibody against Apolipoprotein H(clone EPR2898(2))
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
APOH / Apolipoprotein H Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | APOH / Apolipoprotein H antibody was raised against human beta2-Glycoprotein-I (beta2GP-I) purified from plasma. |
APOH Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human APOH |
Apolipoprotein H (APOH) goat polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IHC |
Reactivities | Canine, Human, Porcine, Rat |
Immunogen | Purified beta2-Glycoprotein-I (beta2GP-I) from human plasma. This protein is also known as apolipoprotein-H. |
Anti-APOH Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 21-262 amino acids of human apolipoprotein H (beta-2-glycoprotein I) |
Rabbit Polyclonal Anti-APOH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOH antibody: synthetic peptide directed towards the middle region of human APOH. Synthetic peptide located within the following region: PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG |
Goat Polyclonal Antibody against APOH (aa145-157)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PSIPTFATLRVYK, from the internal region of the protein sequence according to NP_000033.2. |
Goat Anti-Apolipoprotein H Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGERVKIQEKFKN, from the internal region of the protein sequence according to NP_000033.2 |
Rabbit Polyclonal Anti-APOH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOH antibody: synthetic peptide directed towards the N terminal of human APOH. Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD |
Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-APOH Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 21-262 amino acids of human apolipoprotein H (beta-2-glycoprotein I) |
APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
APOH mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
APOH mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
APOH mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
APOH mouse monoclonal antibody, clone OTI10A6 (formerly 10A6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |