Products

View as table Download

Rabbit Polyclonal Anti-ARRB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.

Goat Polyclonal Antibody against ARRB2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HDHIPLPRPQS, from the internal region of the protein sequence according to NP_004304.1; NP_945355.1.

ARRB2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARRB2

ARRB2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRB2 (NP_004304.1).
Modifications Unmodified

ARRB2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARRB2 (NP_004304.1).