Products

cDNA Clones (38)
Proteins (22)
RNAi (12)
Antibodies (7)
Gene Expression (7)
Jump to Filters
View as table Download
CD83 Mouse Monoclonal Antibody [Clone ID: HB15e]
TA320294

USD 160.00

3 Weeks

Mouse Anti-Human CD83 Purified (25 ug)

Reactivities Human
Conjugation Unconjugated
CD83 Rabbit Polyclonal Antibody
TA347927

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD83 Antibody: A synthesized peptide derived from human CD83
CD83 Rabbit Polyclonal Antibody
TA323348

USD 345.00

4 Weeks

Anti-CD83 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 20-144 amino acids of human CD83 molecule
CD83 Rabbit Polyclonal Antibody
TA343115

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD83 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD83 antibody is: synthetic peptide directed towards the C-terminal region of Human CD83. Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV
CD83 Rabbit Polyclonal Antibody
TA365606

USD 380.00

4 Weeks

CD83 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CD83
CD83 Rabbit Polyclonal Antibody
TA369928

USD 380.00

4 Weeks

CD83 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CD83
CD83 Rabbit Polyclonal Antibody
TA374488

USD 220.00

3 Weeks

CD83 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of human CD83 (NP_004224.1).
Modifications Unmodified