Products

cDNA Clones (28)
Gene Expression (11)
Antibodies (10)
RNAi (10)
Proteins (6)
Jump to Filters
View as table Download
Lass5 (CERS5) (C-term) Rabbit Polyclonal Antibody
AP22658PU-N

USD 440.00

2 Weeks

Lass5 (CERS5) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen LASS5 antibody was raised against lASS5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA306610

USD 430.00

5 Days

Rabbit Polyclonal LASS5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 18 amino acid peptide near the amino terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA331637

USD 375.00

5 Days

Rabbit Polyclonal Anti-LASS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LASS5 Antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: CALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRK
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA306609

USD 430.00

5 Days

Rabbit Polyclonal LASS5 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA306688

USD 430.00

5 Days

Rabbit Polyclonal LASS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LASS5 antibody was raised against a 14 amino acid peptide near the amino terminus of the human LASS5.
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA341466

USD 375.00

5 Days

Rabbit Polyclonal Anti-LASS5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LASS5 antibody: synthetic peptide directed towards the N terminal of human LASS5. Synthetic peptide located within the following region: PCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVR
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA351344

USD 345.00

In Stock

Rabbit Polyclonal Anti-CERS5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CERS5
CERS5 Rabbit Polyclonal Antibody
TA367119

USD 380.00

4 Weeks

CERS5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CERS5
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA374662

USD 220.00

3 Weeks

CERS5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1).
Lass5 (CERS5) Rabbit Polyclonal Antibody
TA374663

USD 220.00

3 Weeks

CERS5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CERS5 (NP_001268660.1).