CPB1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Carboxypeptidase B isolated and purified from Porcine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal CPB1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CPB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 9-37 amino acids from the N-terminal region of human CPB1. |
Rabbit Polyclonal Anti-CPB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPB1 antibody: synthetic peptide directed towards the N terminal of human CPB1. Synthetic peptide located within the following region: SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL |
Rabbit Polyclonal Anti-CPB1 Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CPB1 |
CPB1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CPB1 |
CPB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 111-417 of human CPB1 (NP_001862.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
