Products

View as table Download

Rabbit Polyclonal Anti-DKK2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DKK2

Rabbit Polyclonal Anti-DKK2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DKK2

Goat Polyclonal Antibody against DKK2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence ATYSSKARLHVCQKI, from the C Terminus of the protein sequence according to NP_055236.

Rabbit polyclonal anti-DKK2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 241 of mouse Dkk2 (

Rabbit polyclonal anti-DKK2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 241 of mouse Dkk2

Rabbit Polyclonal Anti-Dkk2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dkk2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMP

DKK2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human DKK2 (NP_055236.1).
Modifications Unmodified