Rabbit Polyclonal Anti-EDA1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EDA1 antibody was raised against an 19 amino acid peptide near the center of human EDA1. |
Rabbit Polyclonal Anti-EDA1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | EDA1 antibody was raised against an 19 amino acid peptide near the center of human EDA1. |
EDA Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human EDA |
Rabbit Polyclonal Anti-EDA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EDA Antibody: synthetic peptide directed towards the middle region of human EDA. Synthetic peptide located within the following region: GPPGPPGPQGPPGLQGPSGAADKAGTRENQPAVVHLQGQGSAIQVKNDLS |
Rabbit Polyclonal Anti-EDA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EDA Antibody: synthetic peptide directed towards the middle region of human EDA. Synthetic peptide located within the following region: HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY |
Rabbit Polyclonal Anti-Eda Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Eda Antibody is: synthetic peptide directed towards the C-terminal region of Rat Eda. Synthetic peptide located within the following region: FASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVH |
Anti-EDA Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 284-298 amino acids of Human Ectodysplasin-A |
Anti-EDA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 284-298 amino acids of Human Ectodysplasin-A |
Rabbit Polyclonal Anti-EDA Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EDA |
EDA rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EDA |