Products

View as table Download

Rabbit Polyclonal EPM2A Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPM2A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human EPM2A.

Goat Anti-Laforin (isoform a) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EATGHTNEMKHTTD, from the internal region of the protein sequence according to NP_005661.1.

Rabbit Polyclonal Anti-EPM2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPM2A antibody is: synthetic peptide directed towards the N-terminal region of Human EPM2A. Synthetic peptide located within the following region: PGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDGVYCLPIG

EPM2A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

EPM2A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EPM2A

EPM2A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EPM2A

EPM2A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 244-331 of human EPM2A (NP_005661.1).
Modifications Unmodified