Products

View as table Download

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C-terminal region of human EXOSC10. Synthetic peptide located within the following region: ACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKP

EXOSC10 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human EXOSC10

EXOSC10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human EXOSC10

EXOSC10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 586-885 of human EXOSC10 (NP_001001998.1).
Modifications Unmodified