Rabbit Polyclonal Anti-Fam3a Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Fam3a antibody is: synthetic peptide directed towards the C-terminal region of Rat Fam3a. Synthetic peptide located within the following region: YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH |
Anti-FAM3A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 34-230 amino acids of human family with sequence similarity 3, member A |
Anti-FAM3A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 34-230 amino acids of human amily with sequence similarity 3, member Aamily with sequence similarity 3, member A |
FAM3A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAM3A |
FAM3A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FAM3A |
FAM3A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAM3A |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
