Fam3a Rabbit Polyclonal Antibody

CAT#: TA338476

Rabbit Polyclonal Anti-Fam3a Antibody

Product Images

Host: Rabbit; Target Name: Fam3a; Sample Tissue: Rat Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fam3a antibody is: synthetic peptide directed towards the C-terminal region of Rat Fam3a. Synthetic peptide located within the following region: YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: family with sequence similarity 3, member A
• Database Link:
  NP_001102794
  Entrez Gene 501664 Rat
• Background: The function of this protein remains unknown.
• Synonyms: 2-19; 2.19; DXS560S; OTTHUMP00000015419; XAP-7
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%