Products

View as table Download

Rabbit polyclonal Fibrillin-1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Fibrillin-1.

Rabbit Polyclonal Anti-FBN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBN1 antibody: synthetic peptide directed towards the N terminal of human FBN1. Synthetic peptide located within the following region: MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGH

Anti-FBN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2837-2853 amino acids of Human fibrillin 1

Anti-FBN1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2837-2853 amino acids of Human fibrillin 1

FBN1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-460 of human FBN1 (NP_000129.3).