Rabbit Polyclonal Anti-FBXO25 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO25 antibody: synthetic peptide directed towards the C terminal of human FBXO25. Synthetic peptide located within the following region: AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF |
Rabbit Polyclonal Anti-FBXO25 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO25 antibody: synthetic peptide directed towards the N terminal of human FBXO25. Synthetic peptide located within the following region: LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL |
Carrier-free (BSA/glycerol-free) FBXO25 mouse monoclonal antibody,clone OTI1A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
FBXO25 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 142-291 of human FBXO25 (NP_036305.2). |
| Modifications | Unmodified |
FBXO25 mouse monoclonal antibody,clone OTI1A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FBXO25 mouse monoclonal antibody,clone OTI1A1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
FBXO25 mouse monoclonal antibody,clone OTI1A1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
FBXO25 mouse monoclonal antibody,clone OTI1A1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
