Products

cDNA Clones (45)
Proteins (18)
Antibodies (13)
RNAi (13)
Gene Expression (9)
Jump to Filters
View as table Download
FBXO25 (NM_183421) Human Tagged ORF Clone
RC208287

USD 420.00

In Stock

FBXO25 (Myc-DDK-tagged)-Human F-box protein 25 (FBXO25), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO25 (NM_012173) Human Tagged ORF Clone
RC205873

USD 420.00

In Stock

FBXO25 (Myc-DDK-tagged)-Human F-box protein 25 (FBXO25), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO25 (NM_183420) Human Tagged ORF Clone
RC223986

USD 420.00

In Stock

FBXO25 (Myc-DDK-tagged)-Human F-box protein 25 (FBXO25), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
FBXO25 (NM_183421) Human Tagged ORF Clone Lentiviral Particle
RC208287L1V

USD 820.00

3 Weeks

Lenti ORF particles, FBXO25 (Myc-DDK tagged) - Human F-box protein 25 (FBXO25), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone Lentiviral Particle
RC208287L2V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO25 (mGFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Fbxo25 (NM_025785) Mouse Tagged ORF Clone
MR205457

USD 300.00

In Stock

Fbxo25 (Myc-DDK-tagged) - Mouse F-box protein 25 (Fbxo25)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO25 (NM_012173) Human Tagged ORF Clone
RG205873

USD 460.00

In Stock

FBXO25 (GFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO25 (NM_183421) Human Tagged ORF Clone
RG208287

USD 460.00

In Stock

FBXO25 (GFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fbxo25 (NM_001014239) Rat Tagged ORF Clone
RR211608

USD 420.00

In Stock

Fbxo25 (Myc-DDK-tagged ORF) - Rat F-box protein 25 (Fbxo25), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
FBXO25 Human Gene Knockout Kit (CRISPR)
KN405873

USD 1,290.00

2 Weeks

FBXO25 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405873 is the updated version of KN205873.
Fbxo25 Mouse Gene Knockout Kit (CRISPR)
KN505813

USD 1,290.00

2 Weeks

Fbxo25 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN505813 is the updated version of KN305813.
Fbxo25 (NM_025785) Mouse Tagged ORF Clone
MG205457

USD 330.00

3 Weeks

Fbxo25 (GFP-tagged) - Mouse F-box protein 25 (Fbxo25)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fbxo25 (NM_025785) Mouse Tagged ORF Clone
MR205457L3

USD 500.00

3 Weeks

Lenti ORF clone of Fbxo25 (Myc-DDK-tagged) - Mouse F-box protein 25 (Fbxo25)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fbxo25 (NM_025785) Mouse Tagged ORF Clone
MR205457L4

USD 500.00

3 Weeks

Lenti ORF clone of Fbxo25 (mGFP-tagged) - Mouse F-box protein 25 (Fbxo25)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_012173) Human Tagged ORF Clone
RC205873L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_012173) Human Tagged ORF Clone Lentiviral Particle
RC205873L3V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO25 (Myc-DDK tagged) - Human F-box protein 25 (FBXO25), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_012173) Human Tagged ORF Clone
RC205873L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_012173) Human Tagged ORF Clone Lentiviral Particle
RC205873L4V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO25 (mGFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone
RC208287L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone Lentiviral Particle
RC208287L3V

USD 820.00

5 Weeks

Lenti ORF particles, FBXO25 (Myc-DDK tagged) - Human F-box protein 25 (FBXO25), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone
RC208287L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone Lentiviral Particle
RC208287L4V

USD 820.00

7 Weeks

Lenti ORF particles, FBXO25 (mGFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183420) Human Tagged ORF Clone
RC223986L3

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183420) Human Tagged ORF Clone Lentiviral Particle
RC223986L3V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO25 (Myc-DDK tagged) - Human F-box protein 25 (FBXO25), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183420) Human Tagged ORF Clone
RC223986L4

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183420) Human Tagged ORF Clone Lentiviral Particle
RC223986L4V

USD 820.00

6 Weeks

Lenti ORF particles, FBXO25 (mGFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
FBXO25 (NM_183420) Human Tagged ORF Clone
RG223986

USD 460.00

3 Weeks

FBXO25 (GFP-tagged) - Human F-box protein 25 (FBXO25), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Fbxo25 (NM_001014239) Rat Tagged ORF Clone
RR211608L3

USD 640.00

4 Weeks

Lenti ORF clone of Fbxo25 (Myc-DDK-tagged ORF) - Rat F-box protein 25 (Fbxo25), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Fbxo25 (NM_001014239) Rat Tagged ORF Clone
RR211608L4

USD 700.00

4 Weeks

Lenti ORF clone of Fbxo25 (mGFP-tagged ORF) - Rat F-box protein 25 (Fbxo25), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Fbxo25 (NM_001014239) Rat Tagged Lenti ORF Clone
RR211608L2

USD 864.00

In Stock

Lenti ORF clone of Fbxo25 (mGFP-tagged ORF) - Rat F-box protein 25 (Fbxo25), (10 ug)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone
RC208287L1

USD 620.00

In Stock

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
FBXO25 (NM_183421) Human Tagged ORF Clone
RC208287L2

USD 620.00

3 Weeks

Lenti ORF clone of Human F-box protein 25 (FBXO25), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Fbxo25 (NM_001014239) Rat Tagged ORF Clone
RR211608L1

USD 640.00

4 Weeks

Lenti ORF clone of Fbxo25 (Myc-DDK-tagged ORF) - Rat F-box protein 25 (Fbxo25), (10 ug)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Fbxo25 Rat shRNA Plasmid (Locus ID 364637)
TL702356

USD 815.00

In Stock

Fbxo25 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
FBXO25 (NM_012173) Human Recombinant Protein
TP760769

USD 215.00

In Stock

Purified recombinant protein of Human F-box protein 25 (FBXO25), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Fbxo25 (NM_025785) Mouse Untagged Clone
MC202921

USD 210.00

In Stock

Fbxo25 (untagged) - Mouse F-box protein 25 (Fbxo25), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO25 (NM_012173) Human Untagged Clone
SC319942

USD 310.00

In Stock

FBXO25 (untagged)-Human F-box protein 25 (FBXO25), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO25 (NM_183421) Human Untagged Clone
SC321837

USD 760.00

In Stock

FBXO25 (untagged)-Human F-box protein 25 (FBXO25), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
FBXO25 Rabbit Polyclonal Antibody
TA329822

USD 310.00

5 Days

Rabbit Polyclonal Anti-FBXO25 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO25 antibody: synthetic peptide directed towards the C terminal of human FBXO25. Synthetic peptide located within the following region: AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF
FBXO25 Rabbit Polyclonal Antibody
TA329821

USD 375.00

5 Days

Rabbit Polyclonal Anti-FBXO25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO25 antibody: synthetic peptide directed towards the N terminal of human FBXO25. Synthetic peptide located within the following region: LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL
FBXO25 Human shRNA Plasmid Kit (Locus ID 26260)
TG304559

USD 715.00

2 Weeks

FBXO25 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
FBXO25 Mouse Monoclonal Antibody [Clone ID: OTI1A1]
CF810350

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FBXO25 mouse monoclonal antibody,clone OTI1A1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FBXO25 Mouse Monoclonal Antibody [Clone ID: OTI6F11]
CF810351

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FBXO25 mouse monoclonal antibody,clone OTI6F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human FBXO25 activation kit by CRISPRa
GA108825

USD 1,290.00

2 Weeks

FBXO25 CRISPRa kit - CRISPR gene activation of human F-box protein 25

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector