Products

View as table Download

FLAD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 558~587 amino acids from the C-terminal region of Human FAD synthetase.

Rabbit polyclonal Anti-FLAD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLAD1 antibody: synthetic peptide directed towards the N terminal of human FLAD1. Synthetic peptide located within the following region: PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV

FLAD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 388-587 of human FLAD1 (NP_079483.3).
Modifications Unmodified