FLAD1 Rabbit Polyclonal Antibody

CAT#: TA331022

Rabbit polyclonal Anti-FLAD1 Antibody

Product Images

WB Suggested Anti-FLAD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: PANC1 cell lysateFLAD1 is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLAD1 antibody: synthetic peptide directed towards the N terminal of human FLAD1. Synthetic peptide located within the following region: PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: flavin adenine dinucleotide synthetase 1
• Database Link:
  NP_079483
  Entrez Gene 80308 Human
  UniProt ID Q8NFF5
• Background: FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Synonyms: FAD1; FADS; LSMFLAD; PP591
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 92%

Reference Data

• Protein Pathways: Metabolic pathways, Riboflavin metabolism