Products

View as table Download

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW

Rabbit Polyclonal anti-Gabra5 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gabra5 antibody: synthetic peptide corresponding to the middle region of mouse GABRA5. Synthetic peptide located within the following region: WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GABRA5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-259 of human GABRA5 (NP_000801.1).
Modifications Unmodified

GABRA5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 32-259 of human GABRA5 (NP_000801.1).
Modifications Unmodified

Anti-GABAA Receptor α5 Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the cytoplasmic loop of the α5 subunit of rat GABAA receptor.

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin