Products

cDNA Clones (37)
Antibodies (26)
Proteins (12)
RNAi (12)
Gene Expression (7)
Jump to Filters
View as table Download
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone
RC228910

USD 420.00

In Stock

GABRA5 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Gabra5 (NM_176942) Mouse Tagged ORF Clone
MR207400

USD 350.00

In Stock

Gabra5 (Myc-DDK-tagged) - Mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 (Gabra5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Tagged ORF Clone Lentiviral Particle
RC216541L1V

USD 820.00

3 Weeks

Lenti ORF particles, GABRA5 (Myc-DDK tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone Lentiviral Particle
RC228910L1V

USD 820.00

3 Weeks

Lenti ORF particles, GABRA5 (Myc-DDK tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone Lentiviral Particle
RC228910L2V

USD 820.00

6 Weeks

Lenti ORF particles, GABRA5 (mGFP-tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Tagged ORF Clone
RG216541

USD 460.00

In Stock

GABRA5 (GFP-tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gabra5 Mouse Gene Knockout Kit (CRISPR)
KN506240

USD 1,290.00

2 Weeks

Gabra5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506240 is the updated version of KN306240.
Gabra5 (NM_176942) Mouse Tagged ORF Clone
MG207400

USD 390.00

3 Weeks

Gabra5 (GFP-tagged) - Mouse gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 5 (Gabra5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gabra5 (NM_176942) Mouse Tagged ORF Clone Lentiviral Particle
MR207400L3V

USD 750.00

6 Weeks

Lenti ORF particles, Gabra5 (Myc-DDK-tagged) - Mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 (Gabra5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gabra5 (NM_176942) Mouse Tagged ORF Clone
MR207400L4

USD 550.00

In Stock

Lenti ORF clone of Gabra5 (mGFP-tagged) - Mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 (Gabra5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gabra5 (NM_176942) Mouse Tagged ORF Clone Lentiviral Particle
MR207400L4V

USD 750.00

3 Weeks

Lenti ORF particles, Gabra5 (GFP-tagged) - Mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 (Gabra5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Tagged ORF Clone Lentiviral Particle
RC216541L3V

USD 820.00

7 Weeks

Lenti ORF particles, GABRA5 (Myc-DDK tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Tagged ORF Clone Lentiviral Particle
RC216541L4V

USD 820.00

7 Weeks

Lenti ORF particles, GABRA5 (mGFP-tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone Lentiviral Particle
RC228910L3V

USD 820.00

6 Weeks

Lenti ORF particles, GABRA5 (Myc-DDK tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone Lentiviral Particle
RC228910L4V

USD 820.00

6 Weeks

Lenti ORF particles, GABRA5 (mGFP-tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone
RG228910

USD 460.00

3 Weeks

GABRA5 (GFP-tagged) - Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gabra5 (NM_017295) Rat Tagged ORF Clone
RR205439

USD 630.00

4 Weeks

Gabra5 (Myc-DDK-tagged ORF) - Rat gamma-aminobutyric acid (GABA) A receptor, alpha 5 (Gabra5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gabra5 (NM_017295) Rat Tagged ORF Clone
RR205439L3

USD 820.00

9 Weeks

Lenti ORF clone of Gabra5 (Myc-DDK-tagged ORF) - Rat gamma-aminobutyric acid (GABA) A receptor, alpha 5 (Gabra5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gabra5 (NM_017295) Rat Tagged ORF Clone Lentiviral Particle
RR205439L3V

USD 1,050.00

13 Weeks

Lenti ORF particles, Gabra5 (Myc-DDK-tagged ORF) - Rat gamma-aminobutyric acid (GABA) A receptor, alpha 5 (Gabra5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gabra5 (NM_017295) Rat Tagged ORF Clone
RR205439L4

USD 910.00

9 Weeks

Lenti ORF clone of Gabra5 (mGFP-tagged ORF) - Rat gamma-aminobutyric acid (GABA) A receptor, alpha 5 (Gabra5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gabra5 (NM_017295) Rat Tagged ORF Clone Lentiviral Particle
RR205439L4V

USD 1,170.00

13 Weeks

Lenti ORF particles, Gabra5 (GFP-tagged ORF) - Rat gamma-aminobutyric acid (GABA) A receptor, alpha 5 (Gabra5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338505

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Untagged Clone
SC119626

USD 760.00

In Stock

GABRA5 (untagged)-Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Gabra5 (NM_176942) Mouse Tagged ORF Clone
MR207400L3

USD 684.00

3 Weeks

Lenti ORF clone of Gabra5 (Myc-DDK-tagged) - Mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 (Gabra5)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) Human qPCR Primer Pair (NM_000810)
HP200751

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GABRA5

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Tagged ORF Clone
RC216541L1

USD 620.00

In Stock

Lenti ORF clone of Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Gabra5 (NM_017295) Rat Untagged Clone
RN205439

USD 630.00

In Stock

Gabra5 (untagged ORF) - Rat gamma-aminobutyric acid (GABA) A receptor, alpha 5 (Gabra5), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Tagged ORF Clone
RC216541L2

USD 620.00

3 Weeks

Lenti ORF clone of Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone
RC228910L1

USD 620.00

In Stock

Lenti ORF clone of Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GABA A Receptor alpha 5 (GABRA5) (NM_001165037) Human Tagged ORF Clone
RC228910L2

USD 620.00

3 Weeks

Lenti ORF clone of Human gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Gabra5 (NM_176942) Mouse Untagged Clone
MC202399

USD 210.00

In Stock

Gabra5 (untagged) - Mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 (Gabra5), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
GABRA5 Human siRNA Oligo Duplex (Locus ID 2558)
SR301699

USD 430.00

In Stock

GABRA5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

GABA A Receptor alpha 5 (GABRA5) (NM_000810) Human Over-expression Lysate
LY400284

USD 605.00

5 Days

Transient overexpression lysate of gamma-aminobutyric acid (GABA) A receptor, alpha 5 (GABRA5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Gabra5 Rabbit Polyclonal Antibody
TA329169

USD 375.00

5 Days

Rabbit Polyclonal anti-Gabra5 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gabra5 antibody: synthetic peptide corresponding to the middle region of mouse GABRA5. Synthetic peptide located within the following region: WTNGSTKSVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLK
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338504

USD 375.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSE
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF806473

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody [Clone ID: OTI1C2]
CF806594

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody [Clone ID: OTI1G5]
CF806598

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human GABA A Receptor alpha 5 (GABRA5) activation kit by CRISPRa
GA101701

USD 1,290.00

2 Weeks

GABRA5 CRISPRa kit - CRISPR gene activation of human gamma-aminobutyric acid type A receptor alpha5 subunit

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gabra5 activation kit by CRISPRa
GA212365

USD 1,290.00

2 Weeks

Gabra5 CRISPRa kit - CRISPR gene activation of mouse gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GABA A Receptor alpha 5 (GABRA5) Human qPCR Template Standard (NM_000810)
HK208412

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GABRA5

Application Plasmid of exact quantity for transcript copy number calculation