Products

View as table Download

GNAI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GNAI2

Rabbit Polyclonal Anti-GNAI2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the C terminal of human GNAI2. Synthetic peptide located within the following region: EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA

Rabbit polyclonal anti-Gai2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 229 of human Gai2

Rabbit Polyclonal Anti-GNAI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAI2 antibody: synthetic peptide directed towards the middle region of human GNAI2. Synthetic peptide located within the following region: EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL

GNAI2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GNAI2

GNAI2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GNAI2

GNAI2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GNAI2

GNAI2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-355 of human GNAI2 (NP_002061.1).
Modifications Unmodified

GNAI2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-355 of human GNAI2 (NP_002061.1).
Modifications Unmodified

GNAI2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-355 of human GNAI2 (NP_002061.1).
Modifications Unmodified