Germany
Japan
United Kingdom
China
Products
Rabbit Polyclonal Anti-JAK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE |
Rabbit Polyclonal Anti-JAK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF |
Rabbit anti JAK3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins. |
Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 750-850 of human JAK3 (NP_000206.2). |
| Modifications | Unmodified |
Phospho-Jak3-Y980/981 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around Y980 of human Jak3 (NP_000206.2). |
| Modifications | Phospho Y980/981 |
Phospho-JAK3 (Tyr785) Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human JAK3 around the phosphorylation site of Tyr785. AA range:751-800 (Phosphorylated) |
JAK3 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI1B4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
JAK3 mouse monoclonal antibody,clone OTI1B4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
JAK3 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI2B4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
JAK3 mouse monoclonal antibody,clone OTI2B4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
JAK3 mouse monoclonal antibody,clone OTI2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
- Antibodies
-
-
-
Target Symbol
- JAK3