Products

View as table Download

JAM3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human JAM3

Rabbit polyclonal anti-JAM3 antibody (C-term)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This JAM3 antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 261-295 amino acids from the C-terminal region of human JAM3.

Rabbit Polyclonal Anti-JAM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JAM3 antibody: synthetic peptide directed towards the N terminal of human JAM3. Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

JAM3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human JAM3

JAM3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human JAM3 (NP_116190.3).
Modifications Unmodified