Products

View as table Download

LILRB5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LILRB5

Rabbit Polyclonal Anti-LILRB5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LILRB5 Antibody is: synthetic peptide directed towards the C-terminal region of Human LILRB5. Synthetic peptide located within the following region: RPAGAAGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAA

Rabbit Polyclonal Anti-LILRB5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LILRB5 antibody is: synthetic peptide directed towards the C-terminal region of Human LILRB5. Synthetic peptide located within the following region: AGPEPKDQGLQKRASPVADIQEEILNAAVKDTQPKDGVEMDARAAASEAP

LILRB5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LILRB5