Goat Polyclonal Anti-PDIA2 (aa477-481) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDIA2 (aa477-481) Antibody: Peptide with sequence C-EYKSTRDLETFSK, from the internal region (near C Terminus) of the protein sequence according to NP_006840.2. |
Rabbit anti-NDRG2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NDRG2 |
Rabbit Polyclonal Anti-NDRG2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDRG2 antibody: synthetic peptide directed towards the C terminal of human NDRG2. Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG |
Rabbit Polyclonal Anti-Ndrg2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ndrg2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TEEKPLLPGQTPETAKEAELAARILLDQGQTHSVETPYGSVTFTVYGTPK |
Germany
Japan
United Kingdom
China
