Products

View as table Download

Rabbit polyclonal anti-NR2F6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6.

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

NR2F6 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-53 amino acids from the N-terminal region of human NR2F6

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR2F6 Antibody: synthetic peptide directed towards the middle region of human NR2F6. Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP

Rabbit Polyclonal Anti-NR2F6 Antibody (Ligand-binding Domain)

Applications IHC
Reactivities Human
Immunogen EAR2 / NR2F6 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR2F6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Pig, Platypus, Xenopus, Stickleback, Pufferfish, Zebrafish (100%); Opossum (94%).

Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2F6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human NR2F6 (NP_005225.2).
Modifications Unmodified

NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated