Products

View as table Download

Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop.

Rabbit Polyclonal Anti-P2RY14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI

Rabbit Polyclonal Anti-P2RY14 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen P2RY14 / GPR105 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY14 / P2Y14. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Marmoset, Mouse (94%); Rat, Hamster, Panda, Dog, Bat, Rabbit, Pig (88%); Bovine, Horse (81%).

P2RY14 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

P2RY14 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human P2RY14

P2RY14 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 209-338 of human P2RY14 (NP_055694.3).
Modifications Unmodified