Products

cDNA Clones (50)
Proteins (10)
RNAi (10)
Gene Expression (9)
Antibodies (6)
Jump to Filters
View as table Download
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone
RC206012

USD 420.00

In Stock

P2RY14 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone
RC224391

USD 420.00

In Stock

P2RY14 (Myc-DDK-tagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone Lentiviral Particle
RC206012L1V

USD 820.00

3 Weeks

Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone Lentiviral Particle
RC206012L2V

USD 820.00

6 Weeks

Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
P2ry14 (NM_133200) Mouse Tagged ORF Clone
MR205036

USD 300.00

In Stock

P2ry14 (Myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_133577) Rat Tagged ORF Clone
RR209163

USD 420.00

In Stock

P2ry14 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_001287119) Mouse Tagged ORF Clone
MR229328

USD 300.00

In Stock

P2ry14 (myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_001287120) Mouse Tagged ORF Clone
MR229329

USD 300.00

In Stock

P2ry14 (myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_001287121) Mouse Tagged ORF Clone
MR229330

USD 300.00

In Stock

P2ry14 (myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_001287122) Mouse Tagged ORF Clone
MR229331

USD 300.00

In Stock

P2ry14 (myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_001287123) Mouse Tagged ORF Clone
MR229332

USD 300.00

In Stock

P2ry14 (myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone
RG206012

USD 460.00

In Stock

P2RY14 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone
RG224391

USD 460.00

In Stock

P2RY14 (GFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR105 (P2RY14) Human Gene Knockout Kit (CRISPR)
KN406012

USD 1,290.00

2 Weeks

P2RY14 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406012 is the updated version of KN206012.
P2ry14 Mouse Gene Knockout Kit (CRISPR)
KN512719

USD 1,290.00

2 Weeks

P2ry14 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512719 is the updated version of KN312719.
P2ry14 (NM_001008497) Mouse Tagged ORF Clone
MG205036

USD 330.00

3 Weeks

P2ry14 (GFP-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
P2ry14 (NM_133200) Mouse Tagged ORF Clone
MR205036L3

USD 500.00

3 Weeks

Lenti ORF clone of P2ry14 (Myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133200) Mouse Tagged ORF Clone Lentiviral Particle
MR205036L3V

USD 700.00

6 Weeks

Lenti ORF particles, P2ry14 (Myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133200) Mouse Tagged ORF Clone
MR205036L4

USD 500.00

3 Weeks

Lenti ORF clone of P2ry14 (mGFP-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133200) Mouse Tagged ORF Clone Lentiviral Particle
MR205036L4V

USD 700.00

6 Weeks

Lenti ORF particles, P2ry14 (GFP-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_001287124) Mouse Tagged ORF Clone
MR229404

USD 360.00

2 Weeks

P2ry14 (myc-DDK-tagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone
RC206012L3

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone Lentiviral Particle
RC206012L3V

USD 820.00

5 Weeks

Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone
RC206012L4

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone Lentiviral Particle
RC206012L4V

USD 820.00

7 Weeks

Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone
RC224391L3

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone Lentiviral Particle
RC224391L3V

USD 820.00

7 Weeks

Lenti ORF particles, P2RY14 (Myc-DDK tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone
RC224391L4

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone Lentiviral Particle
RC224391L4V

USD 820.00

7 Weeks

Lenti ORF particles, P2RY14 (mGFP-tagged) - Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133577) Rat Tagged ORF Clone
RR209163L3

USD 640.00

4 Weeks

Lenti ORF clone of P2ry14 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133577) Rat Tagged ORF Clone Lentiviral Particle
RR209163L3V

USD 850.00

8 Weeks

Lenti ORF particles, P2ry14 (Myc-DDK-tagged ORF) - Rat purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133577) Rat Tagged ORF Clone
RR209163L4

USD 700.00

4 Weeks

Lenti ORF clone of P2ry14 (mGFP-tagged ORF) - Rat purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
P2ry14 (NM_133577) Rat Tagged ORF Clone Lentiviral Particle
RR209163L4V

USD 960.00

8 Weeks

Lenti ORF particles, P2ry14 (GFP-tagged ORF) - Rat purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GPR105 (P2RY14) (NM_014879) Human Untagged Clone
SC114730

USD 310.00

In Stock

P2RY14 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone
RC206012L1

USD 768.00

In Stock

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
P2ry14 (NM_133200) Mouse Untagged Clone
MC203610

USD 210.00

In Stock

P2ry14 (untagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR105 (P2RY14) (NM_001081455) Human Untagged Clone
SC315940

USD 760.00

In Stock

P2RY14 (untagged)-Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR105 (P2RY14) (NM_001081455) Human Over-expression Lysate
LY421155

USD 396.00

In Stock

Transient overexpression lysate of purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
P2ry14 (NM_001008497) Mouse Untagged Clone
MC204185

USD 210.00

In Stock

P2ry14 (untagged) - Mouse purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), transcript variant 2, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR105 (P2RY14) (NM_014879) Human Tagged ORF Clone
RC206012L2

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GPR105 (P2RY14) (NM_001081455) Human Tagged ORF Clone
RC224391L1

USD 620.00

3 Weeks

Lenti ORF clone of Human purinergic receptor P2Y, G-protein coupled, 14 (P2RY14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
P2ry14 (NM_133577) Rat Untagged Clone
RN209163

USD 420.00

In Stock

P2ry14 (untagged ORF) - Rat purinergic receptor P2Y, G-protein coupled, 14 (P2ry14), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GPR105 (P2RY14) (NM_001081455) Human Over-expression Lysate
LC421155

USD 121.00

In Stock

P2RY14 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GPR105 (P2RY14) Rabbit Polyclonal Antibody
TA328671

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-P2Y14 Receptor (extracellular)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide CIELKSELGRKWHKASN, corresponding to amino acid residues 172-188 of human P2Y14. 2nd extracellular loop.
GPR105 (P2RY14) Rabbit Polyclonal Antibody
TA338075

USD 375.00

5 Days

Rabbit Polyclonal Anti-P2RY14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P2RY14 antibody is: synthetic peptide directed towards the C-terminal region of Human P2RY14. Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI
GPR105 (P2RY14) Rabbit Polyclonal Antibody
TA340973

USD 425.00

5 Days

Rabbit Polyclonal Anti-P2RY14 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen P2RY14 / GPR105 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human P2RY14 / P2Y14. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Marmoset, Mouse (94%); Rat, Hamster, Panda, Dog, Bat, Rabbit, Pig (88%); Bovine, Horse (81%).
GPR105 (P2RY14) Human shRNA Plasmid Kit (Locus ID 9934)
TL310644

USD 815.00

2 Weeks

P2RY14 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
GPR105 (P2RY14) Human shRNA Lentiviral Particle (Locus ID 9934)
TL310644V

USD 1,395.00

5 Weeks

P2RY14 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti