Products

View as table Download

Rabbit Polyclonal Anti-PHKG1 Antibody - N-terminal region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phkg1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT

Rabbit Polyclonal Anti-PHKG1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Phkg1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Phkg1. Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

PHKG1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG1

Rabbit polyclonal anti-PHKG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PHKG1.

Rabbit Polyclonal Anti-PHKG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG1

PHKG1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG1

PHKG1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG1

PHKG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 245-350 of human PHKG1 (NP_006204.1).
Modifications Unmodified