PHKG1 Rabbit Polyclonal Antibody

CAT#: TA345153

Rabbit Polyclonal Anti-PHKG1 Antibody - N-terminal region

Product Images

WB Suggested Anti-Phkg1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Phkg1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: phosphorylase kinase catalytic subunit gamma 1
• Database Link:
  NP_006204
  Entrez Gene 29353 RatEntrez Gene 5260 Human
  UniProt ID Q16816
• Background: catalytic subunit of phosphorylase kinase complex; plays a role in glycogen metabolism [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: X07320.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369727, SRS369733 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: PHKG
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 86%; Zebrafish: 77%; Goat: 75%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Calcium signaling pathway, Insulin signaling pathway