Products

cDNA Clones (22)
RNAi (12)
Gene Expression (6)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
PLA2G2E Rabbit Polyclonal Antibody
TA341943

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLA2G2E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP