Germany
Japan
United Kingdom
China
PLA2G2E (Myc-DDK-tagged)-Human phospholipase A2, group IIE (PLA2G2E)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Pla2g2e (Myc-DDK-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PLA2G2E - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN413466 is the updated version of KN213466.
Pla2g2e - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513385 is the updated version of KN313385.
Pla2g2e (GFP-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pla2g2e (Myc-DDK-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pla2g2e (Myc-DDK-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pla2g2e (mGFP-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pla2g2e (GFP-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholipase A2, group IIE (PLA2G2E), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLA2G2E (Myc-DDK tagged) - Human phospholipase A2, group IIE (PLA2G2E), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human phospholipase A2, group IIE (PLA2G2E), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PLA2G2E (mGFP-tagged) - Human phospholipase A2, group IIE (PLA2G2E), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PLA2G2E (GFP-tagged) - Human phospholipase A2, group IIE (PLA2G2E)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pla2g2e (Myc-DDK-tagged ORF) - Rat phospholipase A2, group IIE (Pla2g2e), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pla2g2e (Myc-DDK-tagged ORF) - Rat phospholipase A2, group IIE (Pla2g2e), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pla2g2e (Myc-DDK-tagged ORF) - Rat phospholipase A2, group IIE (Pla2g2e), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pla2g2e (mGFP-tagged ORF) - Rat phospholipase A2, group IIE (Pla2g2e), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pla2g2e (GFP-tagged ORF) - Rat phospholipase A2, group IIE (Pla2g2e), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Pla2g2e (untagged) - Mouse phospholipase A2, group IIE (Pla2g2e), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
PLA2G2E CRISPRa kit - CRISPR gene activation of human phospholipase A2 group IIE
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PLA2G2E
PLA2G2E HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of phospholipase A2, group IIE (PLA2G2E)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qPCR primer pairs and template standards against Mus musculus gene Pla2g2e
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Pla2g2e
AAV ORF Particles, serotype AAV-2, Pla2g2e (Myc-DDK-tagged) - Mouse phospholipase A2, group IIE (Pla2g2e), 250ul, >10^13 TU/mL
- AAV ORF®
-
AAV ORF Particles, serotype AAV-2, PLA2G2E (Myc-DDK-tagged)-Human phospholipase A2, group IIE (PLA2G2E), 250ul, >10^13 TU/mL
- AAV ORF®
-
Pla2g2e (untagged ORF) - Rat phospholipase A2, group IIE (Pla2g2e), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PLA2G2E (untagged)-Human phospholipase A2, group IIE (PLA2G2E)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PLA2G2E (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pla2g2e (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SR425841 is the updated version of SR402729.
Pla2g2e (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of PLA2G2E (NM_014589) in HEK293T cells paraffin embedded controls for ICC/IHC staining
PLA2G2E - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
PLA2G2E - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Pla2g2e - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Pla2g2e - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Pla2g2e - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Pla2g2e - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
PLA2G2E - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Pla2g2e - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Pla2g2e - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of PLA2G2E (NM_014589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLA2G2E (NM_014589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PLA2G2E
Filter by
Species
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Vectors
Mutants
Mammalian Cell Selection
Pathways
- Arachidonic acid metabolism (13)
- Ether lipid metabolism (13)
- Fc epsilon RI signaling pathway (13)
- Glycerophospholipid metabolism (13)
- GnRH signaling pathway (13)
- Linoleic acid metabolism (13)
- Long-term depression (13)
- MAPK signaling pathway (13)
- Metabolic pathways (13)
- VEGF signaling pathway (13)
- Vascular smooth muscle contraction (13)
- alpha-Linolenic acid metabolism (13)