Products

View as table Download

PEN2 (PSENEN) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen PSENEN antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal PEN2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2.

Rabbit Polyclonal PEN2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2.

Rabbit Polyclonal PSENEN/PEN2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human PEN2 (within residues 50-101). [UniProt# Q9NZ42]

Rabbit Polyclonal Anti-PSENEN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT

Psenen Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

PEN2/PSENEN Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1).
Modifications Unmodified

PEN2/PSENEN Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human PEN2/PEN2/PSENEN (NP_758844.1).
Modifications Unmodified