Germany
Japan
United Kingdom
China
PSENEN (Myc-DDK-tagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PSENEN (Myc-DDK tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PSENEN (mGFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Psenen (Myc-DDK-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSENEN (myc-DDK-tagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSENEN (GFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PSENEN - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN403272 is the updated version of KN203272.
Psenen - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514073 is the updated version of KN314073.
Psenen (GFP-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psenen (Myc-DDK-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psenen (Myc-DDK-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psenen (mGFP-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psenen (GFP-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSENEN (Myc-DDK tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PSENEN (mGFP-tagged) - Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Psenen (Myc-DDK-tagged ORF) - Rat presenilin enhancer 2 homolog (C. elegans) (Psenen), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Psenen (Myc-DDK-tagged ORF) - Rat presenilin enhancer 2 homolog (C. elegans) (Psenen), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psenen (Myc-DDK-tagged ORF) - Rat presenilin enhancer 2 homolog (C. elegans) (Psenen), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Psenen (mGFP-tagged ORF) - Rat presenilin enhancer 2 homolog (C. elegans) (Psenen), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Psenen (GFP-tagged ORF) - Rat presenilin enhancer 2 homolog (C. elegans) (Psenen), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PSENEN (untagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human presenilin enhancer 2 homolog (C. elegans) (PSENEN), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PSENEN (untagged)-Human presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PSENEN - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PSENEN HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of presenilin enhancer 2 homolog (C. elegans) (PSENEN)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Psenen (untagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Psenen
qSTAR qPCR primer pairs against Homo sapiens gene PSENEN
Rabbit Polyclonal PSENEN/PEN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human PEN2 (within residues 50-101). [UniProt# Q9NZ42] |
Rabbit Polyclonal Anti-PSENEN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT |
PSENEN CRISPRa kit - CRISPR gene activation of human presenilin enhancer, gamma-secretase subunit
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Psenen CRISPRa kit - CRISPR gene activation of mouse presenilin enhancer gamma secretase subunit
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PSENEN
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Psenen
| Application | Plasmid of exact quantity for transcript copy number calculation |
AAV ORF Particles, serotype AAV-2, Psenen (Myc-DDK-tagged) - Mouse presenilin enhancer 2 homolog (C. elegans) (Psenen), 250ul, >10^13 TU/mL
- AAV ORF®
-
PSENEN MS Standard C13 and N15-labeled recombinant protein (NP_758844)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PSENEN (GFP-tagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Psenen (untagged ORF) - Rat presenilin enhancer 2 homolog (C. elegans) (Psenen), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of presenilin enhancer 2 homolog (C. elegans) (PSENEN) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PSENEN (untagged) - Human presenilin enhancer gamma secretase subunit (PSENEN), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
Psenen (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Psenen (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- PSENEN