PEN2 (PSENEN) (NM_172341) Human Recombinant Protein

CAT#: TP303272

Recombinant protein of human presenilin enhancer 2 homolog (C. elegans) (PSENEN)

Product Images

Coomassie blue staining of purified PSENEN protein (Cat# TP303272). The protein was produced from HEK293T cells transfected with PSENEN cDNA clone (Cat# RC203272) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203272 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIV
  LTSWITIFQIYRPRWGALGDYLSFTIPLGTP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_758844
• Locus ID: 55851
• UniProt ID: Q9NZ42
• Cytogenetics: 19q13.12
• Refseq Size: 834
• Refseq ORF: 303
• Synonyms: ACNINV2; MDS033; MSTP064; PEN-2; PEN2
• Summary: Presenilins, which are components of the gamma-secretase protein complex, are required for intramembranous processing of some type I transmembrane proteins, such as the Notch proteins and the beta-amyloid precursor protein. Signaling by Notch receptors mediates a wide range of developmental cell fates. Processing of the beta-amyloid precursor protein generates neurotoxic amyloid beta peptides, the major component of senile plaques associated with Alzheimer's disease. This gene encodes a protein that is required for Notch pathway signaling, and for the activity and accumulation of gamma-secretase. Mutations resulting in haploinsufficiency for this gene cause familial acne inversa-2 (ACNINV2). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Alzheimer's disease, Notch signaling pathway